PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015899593.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family NF-YB
Protein Properties Length: 173aa    MW: 18916.1 Da    PI: 6.2725
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015899593.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.63.7e-5824121198
           NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                     vreqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplk+yl +yre+eg
  XP_015899593.1  24 VREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKIYLGRYREMEG 118
                     69********************************************************************************************* PP

           NF-YB  96 ekk 98 
                     ++k
  XP_015899593.1 119 DTK 121
                     975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.3E-5619136IPR009072Histone-fold
SuperFamilySSF471132.33E-4127129IPR009072Histone-fold
PfamPF008083.4E-283094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.3E-215876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006159.3E-217795No hitNo description
PRINTSPR006159.3E-2196114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MAEAPVSPGG GSHESGDQSP RSNVREQDRY LPIANISRIM KKALPANGKI AKDAKETVQE  60
CVSEFISFIT SEASDKCQRE KRKTINGDDL LWAMATLGFE DYIEPLKIYL GRYREMEGDT  120
KGSSKGGEAS AKKDVQPSPN AQIAHQASFS QGVSYTNSQS QAQHMMVPMQ GTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A8e-4923115193NF-YB
4awl_B7e-4923115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A7e-4923115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015899593.11e-128PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1
RefseqXP_015899594.11e-128PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1
SwissprotQ8VYK42e-90NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A067EWF51e-116A0A067EWF5_CITSI; Uncharacterized protein
STRINGGLYMA03G33490.11e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.39e-92nuclear factor Y, subunit B8